PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678457356
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 339aa    MW: 37703.7 Da    PI: 6.7504
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678457356genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-092562892255
                SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 +yps++++  LA+ +gL+++q+ +WF N+R ++
  678457356 256 WPYPSEAQKVALAEATGLDQKQINNWFINQRKRH 289
                58*****************************885 PP

2ELK414.1e-14209230122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK qLlrKY+gyLgsLkqEF+
  678457356 209 ELKGQLLRKYGGYLGSLKQEFM 230
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.9E-1768112IPR005540KNOX1
PfamPF037901.0E-1970108IPR005540KNOX1
SMARTSM012562.6E-23118169IPR005541KNOX2
PfamPF037912.7E-21123168IPR005541KNOX2
PROSITE profilePS5121311.174209229IPR005539ELK domain
SMARTSM011883.6E-8209230IPR005539ELK domain
PfamPF037898.1E-11209230IPR005539ELK domain
PROSITE profilePS5007112.714229292IPR001356Homeobox domain
SuperFamilySSF466891.88E-19231303IPR009057Homeodomain-like
SMARTSM003895.2E-13231296IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-27234294IPR009057Homeodomain-like
CDDcd000861.84E-12241293No hitNo description
PfamPF059202.0E-17249288IPR008422Homeobox KN domain
PROSITE patternPS000270267290IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MEGGGSSSGG SCLMGFGGEN SSLFWPLTGY LPPAMMTNNS SDHGGGAYVF TGGDHRYFME  60
TPGGEQLSSI KAKIMAHPLY TRLLAAYVNC QKIGAPAEAV ARLEQACASA AAMVPQGSSN  120
WVAQDPALDQ FMEAYCEMLT KYEQELSKPF KEAMVFLSKI EGQLKALTLI PSYSVCGEAL  180
ERNGSSEEEF ELDVGNNGGF IDPQAEDQEL KGQLLRKYGG YLGSLKQEFM KKRKKGKLPK  240
DARQKLLDWW SRHYKWPYPS EAQKVALAEA TGLDQKQINN WFINQRKRHW KPSEDMQFVV  300
MDAAAHHHPH FYMDNVGAMG NPYAMDISAS MNHHHHHLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224233LKQEFMKKRK
2230234KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444605.11e-141PREDICTED: homeobox protein SBH1-like
SwissprotP466081e-125HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0D2TLX01e-141A0A0D2TLX0_G
STRINGVIT_10s0116g00190.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68352433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-116KNOX/ELK homeobox transcription factor